PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT16491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 608aa    MW: 66211.4 Da    PI: 7.3044
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT16491genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.47.9e-30229285259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               +DgynWrKYG+K+vk+s++p sYY+C++++Cpvkkkver++ d++++ei+Y+g+Hnh+
  EMT16491 229 EDGYNWRKYGKKQVKNSDHPTSYYKCSHQNCPVKKKVERCQ-DGDITEIVYKGSHNHP 285
               8****************************************.***************7 PP

2WRKY105.52.7e-33423481159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vkg+++prsYY+Ct+++Cpv+k+ver+++d k v++tYeg+H+he
  EMT16491 423 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPSCPVRKHVERASNDLKSVITTYEGKHTHE 481
               59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081121.494223287IPR003657WRKY domain
SuperFamilySSF1182906.93E-25226287IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.7E-27228287IPR003657WRKY domain
SMARTSM007746.0E-33228286IPR003657WRKY domain
PfamPF031062.1E-23229285IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-36408483IPR003657WRKY domain
SuperFamilySSF1182905.49E-29415483IPR003657WRKY domain
PROSITE profilePS5081135.99418483IPR003657WRKY domain
SMARTSM007744.2E-38423482IPR003657WRKY domain
PfamPF031061.3E-25424481IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MAGASNRRGA VMEDWMLSTP SPRTLMLSLF NDDFSSGPFS DVSSDSGSNK PHDGMERSKA  60
SVGSSPGESS QVTKTSLHLE PNLFDANEKS SPDSGSPAER NGFCALKIDT SRVGFSASIR  120
SPIIIPPGAQ PSPTTGKLPF LMRTNAKTTI QSVHKKAQEL SHDDHTISFQ QILRSKPTFS  180
IVDKDPSVTH QNQPSASENN HRIPDNEQED SKANRNGEDC PATVIVRAED GYNWRKYGKK  240
QVKNSDHPTS YYKCSHQNCP VKKKVERCQD GDITEIVYKG SHNHPLPPPD RRPGVPFSHS  300
NDLQADGAEN APDDHFQHAH GEVPATNLSA SLSREAFADR SATREAIDVS PPTLSGEDNN  360
REAHGTVSSG IDRDKDVTES KRRMMDYVTP ATAIGTIDIG ALASRAVREA RVIVQTTSEV  420
DVLDDGYRWR KYGQKVVKGN PNPRSYYKCT HPSCPVRKHV ERASNDLKSV ITTYEGKHTH  480
EVPADRKNGC PSSGHGDVAP PPQADGLHWR SGPAQGGIIP QYSGAAAYGS LAQLGVAGGF  540
PFGVLPHGLA LVPVPAQMAG HHPSAMQGNP RLVLQAREFH FMVTEDYLTE KGNTENSADF  600
KQEKWIKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-35229484878Probable WRKY transcription factor 4
2lex_A5e-35229484878Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012702098.20.0PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 2
TrEMBLN1QZ160.0N1QZ16_AEGTA; Putative WRKY transcription factor 2
STRINGSi013374m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-73WRKY DNA-binding protein 2